PSKH2 polyclonal antibody
  • PSKH2 polyclonal antibody

PSKH2 polyclonal antibody

Ref: AB-PAB31452
PSKH2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PSKH2.
Información adicional
Size 100 uL
Gene Name PSKH2
Gene Alias -
Gene Description protein serine kinase H2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDHPWVITMAAGSSMKNLQRAISRNLMQRASPHSQSPGSAQSSKSHYSHKSR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PSKH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 85481
Iso type IgG

Enviar un mensaje


PSKH2 polyclonal antibody

PSKH2 polyclonal antibody