TNFAIP1 polyclonal antibody
  • TNFAIP1 polyclonal antibody

TNFAIP1 polyclonal antibody

Ref: AB-PAB31448
TNFAIP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNFAIP1.
Información adicional
Size 100 uL
Gene Name TNFAIP1
Gene Alias B12|B61|EDP1|MGC2317
Gene Description tumor necrosis factor, alpha-induced protein 1 (endothelial)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TNFAIP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7126
Iso type IgG

Enviar un mensaje


TNFAIP1 polyclonal antibody

TNFAIP1 polyclonal antibody