CYP4F2 polyclonal antibody
  • CYP4F2 polyclonal antibody

CYP4F2 polyclonal antibody

Ref: AB-PAB31441
CYP4F2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CYP4F2.
Información adicional
Size 100 uL
Gene Name CYP4F2
Gene Alias CPF2
Gene Description cytochrome P450, family 4, subfamily F, polypeptide 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CYP4F2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8529
Iso type IgG

Enviar un mensaje


CYP4F2 polyclonal antibody

CYP4F2 polyclonal antibody