PLXDC1 polyclonal antibody
  • PLXDC1 polyclonal antibody

PLXDC1 polyclonal antibody

Ref: AB-PAB31434
PLXDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PLXDC1.
Información adicional
Size 100 uL
Gene Name PLXDC1
Gene Alias DKFZp686F0937|FLJ36270|FLJ45632|TEM3|TEM7
Gene Description plexin domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PLXDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57125
Iso type IgG

Enviar un mensaje


PLXDC1 polyclonal antibody

PLXDC1 polyclonal antibody