NRCAM polyclonal antibody
  • NRCAM polyclonal antibody

NRCAM polyclonal antibody

Ref: AB-PAB31432
NRCAM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NRCAM.
Información adicional
Size 100 uL
Gene Name NRCAM
Gene Alias KIAA0343|MGC138845|MGC138846
Gene Description neuronal cell adhesion molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq REDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NRCAM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4897
Iso type IgG

Enviar un mensaje


NRCAM polyclonal antibody

NRCAM polyclonal antibody