ACVR1C polyclonal antibody
  • ACVR1C polyclonal antibody

ACVR1C polyclonal antibody

Ref: AB-PAB31430
ACVR1C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ACVR1C.
Información adicional
Size 100 uL
Gene Name ACVR1C
Gene Alias ACVRLK7|ALK7
Gene Description activin A receptor, type IC
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ACVR1C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 130399
Iso type IgG

Enviar un mensaje


ACVR1C polyclonal antibody

ACVR1C polyclonal antibody