CD276 polyclonal antibody
  • CD276 polyclonal antibody

CD276 polyclonal antibody

Ref: AB-PAB31416
CD276 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD276.
Información adicional
Size 100 uL
Gene Name CD276
Gene Alias B7-H3|B7H3
Gene Description CD276 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CD276.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 80381
Iso type IgG

Enviar un mensaje


CD276 polyclonal antibody

CD276 polyclonal antibody