MCL1 polyclonal antibody
  • MCL1 polyclonal antibody

MCL1 polyclonal antibody

Ref: AB-PAB31403
MCL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MCL1.
Información adicional
Size 100 uL
Gene Name MCL1
Gene Alias BCL2L3|EAT|MCL1L|MCL1S|MGC104264|MGC1839|TM
Gene Description myeloid cell leukemia sequence 1 (BCL2-related)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MCL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4170
Iso type IgG

Enviar un mensaje


MCL1 polyclonal antibody

MCL1 polyclonal antibody