MMP3 polyclonal antibody
  • MMP3 polyclonal antibody

MMP3 polyclonal antibody

Ref: AB-PAB31395
MMP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MMP3.
Información adicional
Size 100 uL
Gene Name MMP3
Gene Alias CHDS6|MGC126102|MGC126103|MGC126104|MMP-3|SL-1|STMY|STMY1|STR1
Gene Description matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MMP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4314
Iso type IgG

Enviar un mensaje


MMP3 polyclonal antibody

MMP3 polyclonal antibody