CDH6 polyclonal antibody
  • CDH6 polyclonal antibody

CDH6 polyclonal antibody

Ref: AB-PAB31388
CDH6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDH6.
Información adicional
Size 100 uL
Gene Name CDH6
Gene Alias KCAD
Gene Description cadherin 6, type 2, K-cadherin (fetal kidney)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDH6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1004
Iso type IgG

Enviar un mensaje


CDH6 polyclonal antibody

CDH6 polyclonal antibody