SCTR polyclonal antibody
  • SCTR polyclonal antibody

SCTR polyclonal antibody

Ref: AB-PAB31386
SCTR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SCTR.
Información adicional
Size 100 uL
Gene Name SCTR
Gene Alias SR
Gene Description secretin receptor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SCTR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6344
Iso type IgG

Enviar un mensaje


SCTR polyclonal antibody

SCTR polyclonal antibody