USP20 polyclonal antibody
  • USP20 polyclonal antibody

USP20 polyclonal antibody

Ref: AB-PAB31374
USP20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human USP20.
Información adicional
Size 100 uL
Gene Name USP20
Gene Alias KIAA1003|LSFR3A|VDU2
Gene Description ubiquitin specific peptidase 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10868
Iso type IgG

Enviar un mensaje


USP20 polyclonal antibody

USP20 polyclonal antibody