CSNK2B polyclonal antibody
  • CSNK2B polyclonal antibody

CSNK2B polyclonal antibody

Ref: AB-PAB31372
CSNK2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CSNK2B.
Información adicional
Size 100 uL
Gene Name CSNK2B
Gene Alias CK2B|CK2N|CSK2B|G5A|MGC138222|MGC138224
Gene Description casein kinase 2, beta polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CSNK2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1460
Iso type IgG

Enviar un mensaje


CSNK2B polyclonal antibody

CSNK2B polyclonal antibody