GYG2 polyclonal antibody
  • GYG2 polyclonal antibody

GYG2 polyclonal antibody

Ref: AB-PAB31363
GYG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GYG2.
Información adicional
Size 100 uL
Gene Name GYG2
Gene Alias GN-2|GN2
Gene Description glycogenin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq PAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GYG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8908
Iso type IgG

Enviar un mensaje


GYG2 polyclonal antibody

GYG2 polyclonal antibody