IL17RB polyclonal antibody
  • IL17RB polyclonal antibody

IL17RB polyclonal antibody

Ref: AB-PAB31362
IL17RB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IL17RB.
Información adicional
Size 100 uL
Gene Name IL17RB
Gene Alias CRL4|EVI27|IL17BR|IL17RH1|MGC5245
Gene Description interleukin 17 receptor B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IL17RB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55540
Iso type IgG

Enviar un mensaje


IL17RB polyclonal antibody

IL17RB polyclonal antibody