PSMC4 polyclonal antibody
  • PSMC4 polyclonal antibody

PSMC4 polyclonal antibody

Ref: AB-PAB31361
PSMC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PSMC4.
Información adicional
Size 100 uL
Gene Name PSMC4
Gene Alias MGC13687|MGC23214|MGC8570|MIP224|S6|TBP7
Gene Description proteasome (prosome, macropain) 26S subunit, ATPase, 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PSMC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5704
Iso type IgG

Enviar un mensaje


PSMC4 polyclonal antibody

PSMC4 polyclonal antibody