ANXA10 polyclonal antibody
  • ANXA10 polyclonal antibody

ANXA10 polyclonal antibody

Ref: AB-PAB31360
ANXA10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ANXA10.
Información adicional
Size 100 uL
Gene Name ANXA10
Gene Alias ANX14
Gene Description annexin A10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ANXA10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11199
Iso type IgG

Enviar un mensaje


ANXA10 polyclonal antibody

ANXA10 polyclonal antibody