SNCA polyclonal antibody
  • SNCA polyclonal antibody

SNCA polyclonal antibody

Ref: AB-PAB31358
SNCA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SNCA.
Información adicional
Size 100 uL
Gene Name SNCA
Gene Alias MGC110988|NACP|PARK1|PARK4|PD1
Gene Description synuclein, alpha (non A4 component of amyloid precursor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SNCA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6622
Iso type IgG

Enviar un mensaje


SNCA polyclonal antibody

SNCA polyclonal antibody