MFI2 polyclonal antibody
  • MFI2 polyclonal antibody

MFI2 polyclonal antibody

Ref: AB-PAB31349
MFI2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MFI2.
Información adicional
Size 100 uL
Gene Name MFI2
Gene Alias CD228|FLJ38863|MAP97|MGC4856|MTF1
Gene Description antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MFI2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4241
Iso type IgG

Enviar un mensaje


MFI2 polyclonal antibody

MFI2 polyclonal antibody