NNT polyclonal antibody
  • NNT polyclonal antibody

NNT polyclonal antibody

Ref: AB-PAB31342
NNT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NNT.
Información adicional
Size 100 uL
Gene Name NNT
Gene Alias MGC126502|MGC126503
Gene Description nicotinamide nucleotide transhydrogenase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NNT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23530
Iso type IgG

Enviar un mensaje


NNT polyclonal antibody

NNT polyclonal antibody