H6PD polyclonal antibody
  • H6PD polyclonal antibody

H6PD polyclonal antibody

Ref: AB-PAB31295
H6PD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human H6PD.
Información adicional
Size 100 uL
Gene Name H6PD
Gene Alias DKFZp686A01246|G6PDH|GDH|MGC87643
Gene Description hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIAR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 43-154 of human H6PD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9563
Iso type IgG

Enviar un mensaje


H6PD polyclonal antibody

H6PD polyclonal antibody