CD5 polyclonal antibody
  • CD5 polyclonal antibody

CD5 polyclonal antibody

Ref: AB-PAB31255
CD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD5.
Información adicional
Size 100 uL
Gene Name CD5
Gene Alias LEU1|T1
Gene Description CD5 molecule
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDLGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 921
Iso type IgG

Enviar un mensaje


CD5 polyclonal antibody

CD5 polyclonal antibody