CSN2 polyclonal antibody
  • CSN2 polyclonal antibody

CSN2 polyclonal antibody

Ref: AB-PAB31239
CSN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CSN2.
Información adicional
Size 100 uL
Gene Name CSN2
Gene Alias CASB
Gene Description casein beta
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CSN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1447
Iso type IgG

Enviar un mensaje


CSN2 polyclonal antibody

CSN2 polyclonal antibody