C1QTNF4 polyclonal antibody
  • C1QTNF4 polyclonal antibody

C1QTNF4 polyclonal antibody

Ref: AB-PAB31238
C1QTNF4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human C1QTNF4.
Información adicional
Size 100 uL
Gene Name C1QTNF4
Gene Alias CTRP4|ZACRP4
Gene Description C1q and tumor necrosis factor related protein 4
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRCRVPGAYFFSFT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human C1QTNF4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 114900
Iso type IgG

Enviar un mensaje


C1QTNF4 polyclonal antibody

C1QTNF4 polyclonal antibody