MS4A4E polyclonal antibody
  • MS4A4E polyclonal antibody

MS4A4E polyclonal antibody

Ref: AB-PAB31231
MS4A4E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MS4A4E.
Información adicional
Size 100 uL
Gene Name MS4A4E
Gene Alias -
Gene Description membrane-spanning 4-domains, subfamily A, member 4E
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LQQELEQQKVWNYLKNLSWRIMGSYLCFGERSELKPL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MS4A4E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 643680
Iso type IgG

Enviar un mensaje


MS4A4E polyclonal antibody

MS4A4E polyclonal antibody