DGKH polyclonal antibody
  • DGKH polyclonal antibody

DGKH polyclonal antibody

Ref: AB-PAB31227
DGKH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DGKH.
Información adicional
Size 100 uL
Gene Name DGKH
Gene Alias DGKeta|DKFZp761I1510
Gene Description diacylglycerol kinase, eta
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DGKH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 160851
Iso type IgG

Enviar un mensaje


DGKH polyclonal antibody

DGKH polyclonal antibody