MYO1H polyclonal antibody
  • MYO1H polyclonal antibody

MYO1H polyclonal antibody

Ref: AB-PAB31226
MYO1H polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MYO1H.
Información adicional
Size 100 uL
Gene Name MYO1H
Gene Alias FLJ37587
Gene Description myosin IH
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSTSNLSDGILVIHVSPEDSKQKGDAVLQCGHVFEAVTKLVMLVKKENIVNVVQGSLQFFISPGKEGTIVFDTGPEEQVYKNKNGQLTVVSG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MYO1H.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 283446
Iso type IgG

Enviar un mensaje


MYO1H polyclonal antibody

MYO1H polyclonal antibody