NRIP2 polyclonal antibody
  • NRIP2 polyclonal antibody

NRIP2 polyclonal antibody

Ref: AB-PAB31224
NRIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NRIP2.
Información adicional
Size 100 uL
Gene Name NRIP2
Gene Alias DKFZp761G1913
Gene Description nuclear receptor interacting protein 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NRIP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 83714
Iso type IgG

Enviar un mensaje


NRIP2 polyclonal antibody

NRIP2 polyclonal antibody