ANAPC4 polyclonal antibody
  • ANAPC4 polyclonal antibody

ANAPC4 polyclonal antibody

Ref: AB-PAB31215
ANAPC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ANAPC4.
Información adicional
Size 100 uL
Gene Name ANAPC4
Gene Alias APC4
Gene Description anaphase promoting complex subunit 4
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ANAPC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 29945
Iso type IgG

Enviar un mensaje


ANAPC4 polyclonal antibody

ANAPC4 polyclonal antibody