ARSB polyclonal antibody
  • ARSB polyclonal antibody

ARSB polyclonal antibody

Ref: AB-PAB31207
ARSB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ARSB.
Información adicional
Size 100 uL
Gene Name ARSB
Gene Alias ASB|G4S|MPS6
Gene Description arylsulfatase B
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ARSB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 411
Iso type IgG

Enviar un mensaje


ARSB polyclonal antibody

ARSB polyclonal antibody