PIWIL4 polyclonal antibody
  • PIWIL4 polyclonal antibody

PIWIL4 polyclonal antibody

Ref: AB-PAB31200
PIWIL4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PIWIL4.
Información adicional
Size 100 uL
Gene Name PIWIL4
Gene Alias DKFZp686P01248|FLJ36156|HIWI2|MIWI2
Gene Description piwi-like 4 (Drosophila)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCILPSNQKTYYDSI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PIWIL4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 143689
Iso type IgG

Enviar un mensaje


PIWIL4 polyclonal antibody

PIWIL4 polyclonal antibody