GPR152 polyclonal antibody
  • GPR152 polyclonal antibody

GPR152 polyclonal antibody

Ref: AB-PAB31187
GPR152 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GPR152.
Información adicional
Size 100 uL
Gene Name GPR152
Gene Alias MGC148162|PGR5
Gene Description G protein-coupled receptor 152
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GPR152.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 390212
Iso type IgG

Enviar un mensaje


GPR152 polyclonal antibody

GPR152 polyclonal antibody