ACAP2 polyclonal antibody
  • ACAP2 polyclonal antibody

ACAP2 polyclonal antibody

Ref: AB-PAB31183
ACAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ACAP2.
Información adicional
Size 100 uL
Gene Name ACAP2
Gene Alias CENTB2|CNT-B2|KIAA0041
Gene Description ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ACAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23527
Iso type IgG

Enviar un mensaje


ACAP2 polyclonal antibody

ACAP2 polyclonal antibody