MAPK8IP2 polyclonal antibody
  • MAPK8IP2 polyclonal antibody

MAPK8IP2 polyclonal antibody

Ref: AB-PAB31182
MAPK8IP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAPK8IP2.
Información adicional
Size 100 uL
Gene Name MAPK8IP2
Gene Alias IB2|JIP2|PRKM8IPL
Gene Description mitogen-activated protein kinase 8 interacting protein 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEM
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAPK8IP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23542
Iso type IgG

Enviar un mensaje


MAPK8IP2 polyclonal antibody

MAPK8IP2 polyclonal antibody