TENC1 polyclonal antibody
  • TENC1 polyclonal antibody

TENC1 polyclonal antibody

Ref: AB-PAB31181
TENC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TENC1.
Información adicional
Size 100 uL
Gene Name TENC1
Gene Alias C1-TEN|C1TEN|DKFZp686D13244|FLJ16320|KIAA1075|TNS2
Gene Description tensin like C1 domain containing phosphatase (tensin 2)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TENC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23371
Iso type IgG

Enviar un mensaje


TENC1 polyclonal antibody

TENC1 polyclonal antibody