PPEF1 polyclonal antibody
  • PPEF1 polyclonal antibody

PPEF1 polyclonal antibody

Ref: AB-PAB31180
PPEF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PPEF1.
Información adicional
Size 100 uL
Gene Name PPEF1
Gene Alias PP7|PPEF|PPP7C
Gene Description protein phosphatase, EF-hand calcium binding domain 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PPEF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5475
Iso type IgG

Enviar un mensaje


PPEF1 polyclonal antibody

PPEF1 polyclonal antibody