EDN1 polyclonal antibody
  • EDN1 polyclonal antibody

EDN1 polyclonal antibody

Ref: AB-PAB31178
EDN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human EDN1.
Información adicional
Size 100 uL
Gene Name EDN1
Gene Alias ET1|HDLCQ7
Gene Description endothelin 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EDN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1906
Iso type IgG

Enviar un mensaje


EDN1 polyclonal antibody

EDN1 polyclonal antibody