AB-PAB31178
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Size | 100 uL |
Gene Name | EDN1 |
Gene Alias | ET1|HDLCQ7 |
Gene Description | endothelin 1 |
Storage Conditions | Store at 4ºC for short term storage. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | IHC-P,IF |
Immunogen Prot. Seq | PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH |
Form | Liquid |
Recomended Dilution | Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | Recombinant protein corresponding to human EDN1. |
Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Gene ID | 1906 |
Iso type | IgG |