ITGA2B polyclonal antibody
  • ITGA2B polyclonal antibody

ITGA2B polyclonal antibody

Ref: AB-PAB31165
ITGA2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITGA2B.
Información adicional
Size 100 uL
Gene Name ITGA2B
Gene Alias CD41|CD41B|GP2B|GPIIb|GTA|HPA3
Gene Description integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITGA2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3674
Iso type IgG

Enviar un mensaje


ITGA2B polyclonal antibody

ITGA2B polyclonal antibody