GCNT1 polyclonal antibody
  • GCNT1 polyclonal antibody

GCNT1 polyclonal antibody

Ref: AB-PAB31162
GCNT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GCNT1.
Información adicional
Size 100 uL
Gene Name GCNT1
Gene Alias C2GNT|C2GNT-L|C2GNT1|G6NT|MGC126335|MGC126336|NACGT2|NAGCT2
Gene Description glucosaminyl (N-acetyl) transferase 1, core 2 (beta-1,6-N-acetylglucosaminyltransferase)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GCNT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2650
Iso type IgG

Enviar un mensaje


GCNT1 polyclonal antibody

GCNT1 polyclonal antibody