ProSAPiP1 polyclonal antibody
  • ProSAPiP1 polyclonal antibody

ProSAPiP1 polyclonal antibody

Ref: AB-PAB31157
ProSAPiP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ProSAPiP1.
Información adicional
Size 100 uL
Gene Name ProSAPiP1
Gene Alias KIAA0552
Gene Description ProSAPiP1 protein
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KSGSSSSMGRPGHLGSGEGGGGGLPFAACSPPSPSALIQELEERLWEKEQEVAALRRSLEQSEAAVAQVLEERQKAWERELAELRQGCSGKLQQVAR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ProSAPiP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9762
Iso type IgG

Enviar un mensaje


ProSAPiP1 polyclonal antibody

ProSAPiP1 polyclonal antibody