PIK3C2B polyclonal antibody
  • PIK3C2B polyclonal antibody

PIK3C2B polyclonal antibody

Ref: AB-PAB31154
PIK3C2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PIK3C2B.
Información adicional
Size 100 uL
Gene Name PIK3C2B
Gene Alias C2-PI3K|DKFZp686G16234
Gene Description phosphoinositide-3-kinase, class 2, beta polypeptide
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELYCNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PIK3C2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5287
Iso type IgG

Enviar un mensaje


PIK3C2B polyclonal antibody

PIK3C2B polyclonal antibody