KIAA1324 polyclonal antibody
  • KIAA1324 polyclonal antibody

KIAA1324 polyclonal antibody

Ref: AB-PAB31140
KIAA1324 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human KIAA1324.
Información adicional
Size 100 uL
Gene Name KIAA1324
Gene Alias EIG121|MGC150624
Gene Description KIAA1324
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLCYNDCTFSRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITSPAELFHLESLGIPDVIF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KIAA1324.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57535
Iso type IgG

Enviar un mensaje


KIAA1324 polyclonal antibody

KIAA1324 polyclonal antibody