IFITM3 polyclonal antibody
  • IFITM3 polyclonal antibody

IFITM3 polyclonal antibody

Ref: AB-PAB31118
IFITM3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IFITM3.
Información adicional
Size 100 uL
Gene Name IFITM3
Gene Alias 1-8U|IP15
Gene Description interferon induced transmembrane protein 3 (1-8U)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 1-57 of human IFITM3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10410
Iso type IgG

Enviar un mensaje


IFITM3 polyclonal antibody

IFITM3 polyclonal antibody