FZD4 polyclonal antibody
  • FZD4 polyclonal antibody

FZD4 polyclonal antibody

Ref: AB-PAB31108
FZD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FZD4.
Información adicional
Size 100 uL
Gene Name FZD4
Gene Alias CD344|EVR1|FEVR|FZD4S|Fz-4|FzE4|GPCR|MGC34390
Gene Description frizzled homolog 4 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IF
Immunogen Prot. Seq PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FZD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8322
Iso type IgG

Enviar un mensaje


FZD4 polyclonal antibody

FZD4 polyclonal antibody