PIK3CB polyclonal antibody
  • PIK3CB polyclonal antibody

PIK3CB polyclonal antibody

Ref: AB-PAB31105
PIK3CB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PIK3CB.
Información adicional
Size 100 uL
Gene Name PIK3CB
Gene Alias DKFZp779K1237|MGC133043|PI3K|PI3KCB|PI3Kbeta|PIK3C1|p110-BETA
Gene Description phosphoinositide-3-kinase, catalytic, beta polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IF
Immunogen Prot. Seq LSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGK
Form Liquid
Recomended Dilution Western Blot (1:500-1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PIK3CB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5291
Iso type IgG

Enviar un mensaje


PIK3CB polyclonal antibody

PIK3CB polyclonal antibody