IL1R1 polyclonal antibody
  • IL1R1 polyclonal antibody

IL1R1 polyclonal antibody

Ref: AB-PAB31085
IL1R1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IL1R1.
Información adicional
Size 100 uL
Gene Name IL1R1
Gene Alias CD121A|D2S1473|IL-1R-alpha|IL1R|IL1RA|P80
Gene Description interleukin 1 receptor, type I
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IL1R1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3554
Iso type IgG

Enviar un mensaje


IL1R1 polyclonal antibody

IL1R1 polyclonal antibody