USP33 polyclonal antibody
  • USP33 polyclonal antibody

USP33 polyclonal antibody

Ref: AB-PAB31079
USP33 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human USP33.
Información adicional
Size 100 uL
Gene Name USP33
Gene Alias KIAA1097|MGC16868|VDU1
Gene Description ubiquitin specific peptidase 33
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq ESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP33.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23032
Iso type IgG

Enviar un mensaje


USP33 polyclonal antibody

USP33 polyclonal antibody