FGF19 polyclonal antibody
  • FGF19 polyclonal antibody

FGF19 polyclonal antibody

Ref: AB-PAB31066
FGF19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FGF19.
Información adicional
Size 100 uL
Gene Name FGF19
Gene Alias -
Gene Description fibroblast growth factor 19
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FGF19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9965
Iso type IgG

Enviar un mensaje


FGF19 polyclonal antibody

FGF19 polyclonal antibody