PRKCG polyclonal antibody
  • PRKCG polyclonal antibody

PRKCG polyclonal antibody

Ref: AB-PAB31057
PRKCG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PRKCG.
Información adicional
Size 100 uL
Gene Name PRKCG
Gene Alias MGC57564|PKC-gamma|PKCC|PKCG|SCA14
Gene Description protein kinase C, gamma
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PRKCG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5582
Iso type IgG

Enviar un mensaje


PRKCG polyclonal antibody

PRKCG polyclonal antibody