PLD1 polyclonal antibody
  • PLD1 polyclonal antibody

PLD1 polyclonal antibody

Ref: AB-PAB31055
PLD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PLD1.
Información adicional
Size 100 uL
Gene Name PLD1
Gene Alias -
Gene Description phospholipase D1, phosphatidylcholine-specific
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PLD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5337
Iso type IgG

Enviar un mensaje


PLD1 polyclonal antibody

PLD1 polyclonal antibody